DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and ctbs

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001011500.1 Gene:ctbs / 497004 XenbaseID:XB-GENE-975891 Length:369 Species:Xenopus tropicalis


Alignment Length:395 Identity:94/395 - (23%)
Similarity:151/395 - (38%) Gaps:84/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LCTHLVYAFGGFTKDNQMKPFDKYQDIE-QGGYAKFTGLKTYNKQLKTMIAIGGWNE------AS 115
            ||..|..|....|.....:|....:|.| ...|.|....|.|:....|.||:.|..:      |.
 Frog    18 LCVSLCAAGCPCTDPRLCEPITDSRDFEVLVFYTKGKNWKFYDWSQVTTIALFGKYDPELLCFAH 82

  Fly   116 SRFS----------PLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYA- 169
            |:.:          |.:...:.|..:|...::..:....|||:||.|     :.......:.|| 
 Frog    83 SKGARLVLKGDVPLPYIVDLKNRTSWITQKVELAKSQFMDGINLDIE-----QSVLKGSPEYYAL 142

  Fly   170 -QFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYID-KGYDVPKLNKYLDWFNVLTYDFHSS-- 230
             ..|:|....|.||...:     .:|..|....:.:| :.|:...:.:..|:..|::||..|.  
 Frog   143 TALVEETTEAFHREIPGS-----QVTFDVAWSPDCVDERCYNYTGIAESCDFLFVMSYDEQSQIW 202

  Fly   231 HEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTE 295
            .|...:.::||.  :..|.|....:|:|            |..|||:|:|.||..|..::.|...
 Frog   203 TECVASANSPLN--KTLSGYQKFTQLDI------------DPKKLVMGVPWYGYDYPCLDLEDNN 253

  Fly   296 L--------GAP-AEGPGEQGDATREKGYLAYYEICQTLKDDPE---WTVVQPNANVMGP-YAYR 347
            .        ||| ::..|:|         :.|.:|.:.:.....   |..||.:     | |.|:
 Frog   254 CTLKEVPFRGAPCSDAAGKQ---------IPYSKITKQVNSSLTGRLWDDVQKS-----PFYNYK 304

  Fly   348 --RNQW--VGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIEAAKEAMVEAL 408
              :.|:  |.|||...:..|:.|:...||.||..|..|..|:      ...|:.|...:.|..||
 Frog   305 DAKGQFHQVWYDDPVSISLKSAYIKKLGLRGIGMWNGDLLDY------SQDPIAETQTKDMWNAL 363

  Fly   409 -GLGI 412
             |:|:
 Frog   364 KGVGL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 86/363 (24%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 89/384 (23%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
ctbsNP_001011500.1 GH18_chitobiase 9..363 CDD:119354 90/388 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.