DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and obst-F

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:400 Identity:80/400 - (20%)
Similarity:137/400 - (34%) Gaps:107/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 LLLTMAVPAGIEY-IDKGYDVPKLNKYLDWFNVLTYDFHSSH------EPSVNHHAPLYSLEEDS 248
            |.|::....|..: :|:.:::||:...:.         |.||      |..:..| ||......|
  Fly     9 LALSICFQLGAGHAVDQSWELPKVRHTVG---------HLSHICLGRQEGDLVPH-PLDCNGYFS 63

  Fly   249 EYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREK 313
            .......|..|..:::      |.::.:..:|           |:|.....|.|..|..:...:.
  Fly    64 CSRVPTLLYCDQGLQF------DENRAICDLP-----------ENTNCRPVATGTVESANGLADN 111

  Fly   314 GYLAYYEICQTLKDDPEWTVV-----QPNANVMGPYAYRRNQWVGYDDEAI-VRKKAEYVVAQGL 372
            ..|.::    ..|..|.:..|     ||           .|....||.|.| .|....|.:....
  Fly   112 SELNWW----PHKPKPVFVAVDVTSGQP-----------VNPMEKYDPEHIECRHYGAYFLPHPR 161

  Fly   373 G-GIMFWAIDNDDFRGTC-NGKPYPLIEAAKEAMVEALGLGINEVAKPSGPQKPSRSRSRDNASN 435
            . |:.|........|..| .|..:...::..:...:|:..|.:::::|                 
  Fly   162 NCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEP----------------- 209

  Fly   436 RNRLNGKTEAPLSSRRPSATRRPAVSSTQAPPPS--TTFK--LTEAEGSSLYIGGRASTTPPPPT 496
                  .|:...:.:.|:|....||:.......|  ||.:  ||..|.:.|          ||.|
  Fly   210 ------HTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITEL----------PPVT 258

  Fly   497 TPDP----GSDFKC--EEEGFFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCD 555
            .|.|    .:...|  .::.:..||.||.|||.|:...|.       :.:||.||:::..:..|:
  Fly   259 PPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPV-------LTSCPKGLFWDQKSGFCE 316

  Fly   556 FARNVPCKTK 565
            ..:||.|..|
  Fly   317 MEKNVKCFQK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 38/205 (19%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 41/227 (18%)
CBM_14 506..562 CDD:279884 17/57 (30%)
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 11/68 (16%)
CBM_14 156..198 CDD:279884 5/41 (12%)
CBM_14 272..321 CDD:279884 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.