DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Cht2

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster


Alignment Length:477 Identity:171/477 - (35%)
Similarity:252/477 - (52%) Gaps:79/477 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFLLCALAYCINE--ASSEGR--------VVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFG 67
            |:||..||...:.  ||...|        ||||.:.|:||||....:..:|.:|.||||:||||.
  Fly    14 LWLLLLLASTASSLWASVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFA 78

  Fly    68 GF-TKDNQMKPFDKYQDIEQ----GGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNER 127
            |. .....:|..|.:||:::    |||.|.||||..:..||..:|||||||.|:.:|.|||:|..
  Fly    79 GLDITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLL 143

  Fly   128 RQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLL 192
            |.:|:|.:..|:|:.:|||:|||||||..|: ||..||:|:....:|||.||:...       ||
  Fly   144 RGRFVKQVSSFIRKYNFDGLDLDWEYPTQRK-GKPADRENFVLLTKELREEFDEHG-------LL 200

  Fly   193 LTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELN 257
            ||.|:.|..:.||:.|||.::::|||:.:::.||:|.|.:..|.::|||.:..:|       .|:
  Fly   201 LTSAIGASKKVIDEAYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTAPADD-------PLS 258

  Fly   258 IDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEIC 322
            :.:||.|.||.||..:|||:|:|.|||::..:  .|..|...:||.|.:|..|||.|:|.|.|||
  Fly   259 VKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTL--ASGFLNDVSEGVGFKGPYTREDGFLGYNEIC 321

  Fly   323 QTLKD---------DPEWTVVQPNANVMGPYAYRRNQW------VGYDDEAIVRKKAEYVVAQGL 372
            |||.:         ||:.:.|...:        .||.:      |.||....:..|..:.:::.|
  Fly   322 QTLSNQTSGWTREWDPQTSQVLAKS--------ERNVFTQEINVVTYDSSRSIANKVLFAMSKRL 378

  Fly   373 GGIMFWAIDNDDFRGTC-------------------NGKPYPLIEAAKEAMVEALGLGINEVAKP 418
            .|:|.|::|.|||.|.|                   :.:.|||:....||.:    |.::|:|.|
  Fly   379 AGVMVWSVDTDDFLGNCKLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEATM----LAVDELAVP 439

  Fly   419 SGPQKPSRSRSRDNASNRNRLN 440
            . ||.........:.|..:|.|
  Fly   440 E-PQPDDSENEIPHGSIADRKN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 145/379 (38%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 153/410 (37%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 144/371 (39%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 152/409 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48394at33392
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.