DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Cht9

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster


Alignment Length:386 Identity:138/386 - (35%)
Similarity:207/386 - (53%) Gaps:31/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLCALA-YCINEASSEGRVV-CYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKP 77
            ||..|| .|:::.....|:| ||:..|:.||.|..||:..||:..|||||.|:|.|...:.:::.
  Fly     4 LLALLAVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQS 68

  Fly    78 FDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQN 142
            .|.:.|.:.|...:...||..|..||.:..:|||||.|:::|.:.....:||.||.:.|..||.:
  Fly    69 LDTWLDYDLGFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNH 133

  Fly   143 HFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDKG 207
            .|||:|||||||..| ||...||.|:...::|::..|.....:.|       :||.||.......
  Fly   134 GFDGLDLDWEYPNQR-GGNWNDRANFVTLLREIKEAFAPYGYELG-------IAVGAGESLASAS 190

  Fly   208 YDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADR 272
            |::..:.:.:|:.||:||||..:.:.....:||.:::|.              :|.::|..||..
  Fly   191 YEIANIAQQVDFINVMTYDFAMASDGQTGFNAPQWAVEN--------------AINFWLSQGAPA 241

  Fly   273 DKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPN 337
            :|||||:.|||||:.|.:......|||..|.|..|..|...|||.|.||||.     .|..|...
  Fly   242 NKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQN-----NWHTVFDY 301

  Fly   338 ANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIE 398
            .|. .||||..:|||.:|:...|:.|.::.:::||.|.|.|:::.||:||.| |:.|||::
  Fly   302 DNA-APYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQC-GETYPLLK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 124/352 (35%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 132/368 (36%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 132/367 (36%)
Glyco_18 23..346 CDD:214753 123/350 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.