DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Idgf3

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster


Alignment Length:450 Identity:124/450 - (27%)
Similarity:205/450 - (45%) Gaps:70/450 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GAAWQTLFL-LCALAYCINEASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYL--CTHLVYAFGG 68
            |:.|.:|.| |..||..  :.|:...:||:|.:....|.|.|:|:..:|...|  ||||||.:.|
  Fly     3 GSLWLSLALSLAVLAQF--KVSAAPNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAG 65

  Fly    69 FTKDN-QMKPFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGG---WNEASSRFSPLVASNERRQ 129
            ...|| :|:..:|..|:||...|:.|.:|.....:|.::::||   ..|.:.....|.:..:..:
  Fly    66 VNADNYEMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHR 130

  Fly   130 QFIKNILKFLRQNHFDGIDLDWEYP------AHREGGKSRDRDNYAQFVQELRAEF----EREAE 184
            :||::....:|:.:|||:||..:.|      .|.:.|.:     :..|.:....:|    |.|..
  Fly   131 RFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSA-----WKSFKKFFTGDFIVDTESETH 190

  Fly   185 KTGRTR-------------LLLTMAVPAGIE---YIDKGYDVPKLNKYLDWFNVLTYDF--HSSH 231
            |...|.             |||::.|...:.   |    ||.|.:...||:.|:.|:||  ...:
  Fly   191 KGQVTALIKDLSAALKQNDLLLSLTVLPNVNSSWY----YDAPSIAPSLDFINLGTFDFLTPQRN 251

  Fly   232 EPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTEL 296
            ....:..||.|   |....|.....|:::.::::|......:|:.:||.|||||:.: :::|.:.
  Fly   252 PEEADFSAPTY---EAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKM-SKDSGDS 312

  Fly   297 GAP----AEGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANV---------MGPYAYR- 347
            |.|    .:||...|..::::|.|.:.|||..:.:........|||.|         .|.||:| 
  Fly   313 GMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRA 377

  Fly   348 ------RNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIEAAK 401
                  ...|:.|||......||.|..|:.|||:..:.:..|||||.|....:|::.|.|
  Fly   378 ADENGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQCTNDRFPMLRAIK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 107/405 (26%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 115/423 (27%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 115/424 (27%)
Glyco_18 27..419 CDD:214753 107/404 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.