DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Idgf2

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_477257.2 Gene:Idgf2 / 34979 FlyBaseID:FBgn0020415 Length:440 Species:Drosophila melanogaster


Alignment Length:449 Identity:130/449 - (28%)
Similarity:207/449 - (46%) Gaps:74/449 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WQTLFLLCALAYCINEASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYL------CTHLVYAFGG 68
            |.| |:.|..|.....||:   :||||.:.|..|.|..|.    :||.|      |:||||.:.|
  Fly     6 WFT-FVACLFAASTEAASN---LVCYYDSSSYTREGLGKL----LNPDLEIALQFCSHLVYGYAG 62

  Fly    69 FTKDN-QMKPFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEAS----SRFSPLVASNERR 128
            ...:| |....::..||.:..:::.|.||.....||.::::||.::..    :::..|:...:.|
  Fly    63 LRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVR 127

  Fly   129 Q-QFIKNILKFLRQNHFDGIDLDWEYP------AHREGG---KSRDRDNYAQFVQELRAEFEREA 183
            | .||::....::...|||:||.:::|      .|.:.|   ||..:.....|:.:..|...:| 
  Fly   128 QIGFIRSAYDLVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKE- 191

  Fly   184 EKTGRTR----------LLLTMAVPAGIE---YIDKGYDVPKLNKYLDWFNVLTYDF--HSSHEP 233
            :.|...|          .||::.|...:.   |    :|:|.||..:|:.|:.|:||  .:.:..
  Fly   192 QFTALVRDVKDSLRADGFLLSLTVLPNVNSTWY----FDIPALNGLVDFVNLATFDFLTPARNPE 252

  Fly   234 SVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGA 298
            ..::.||:|  ..|...:..|.||.|:.::|:|..|...:|:.||:.|||.::.|..:...| |.
  Fly   253 EADYSAPIY--HPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLE-GV 314

  Fly   299 P----AEGPGEQGDATREKGYLAYYEIC--------QTLK--DDPEWTVVQPNANVMGPYAYR-- 347
            |    ..||..:|..:::.|.|:|.|||        |.||  :.|...|..|... .|..|||  
  Fly   315 PVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKR-FGGIAYRPV 378

  Fly   348 -----RNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYPLIEAAK 401
                 ...||.|||......||.|...:.|||:..:.:..|||||.|:|..||::.|.|
  Fly   379 DGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 112/408 (27%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 123/427 (29%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Idgf2NP_477257.2 GH18_IDGF 23..440 CDD:119352 123/431 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.