DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and RGD1309110

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:XP_006233175.1 Gene:RGD1309110 / 295352 RGDID:1309110 Length:440 Species:Rattus norvegicus


Alignment Length:396 Identity:142/396 - (35%)
Similarity:220/396 - (55%) Gaps:16/396 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFLLCALAYCIN-EASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMK 76
            |..:..|...:| :..|..:::||:.||..|:|........:|:|.|||||:|:|.|..::|  .
  Rat    21 LVFIMGLNLLLNVQLDSAYQLMCYFNNWPQYQPDVRGMKLDDIDPCLCTHLIYSFAGIWENN--N 83

  Fly    77 PFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQ 141
            ...|.:|::.  |.:|..||..|.:|||:::||.||..:..|..:|::.|.|..||.::.||||:
  Rat    84 TMTKRKDLDD--YKEFNDLKKRNNKLKTLLSIGCWNFEAGLFITMVSTPESRHTFITSVRKFLRK 146

  Fly   142 NHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDK 206
            ..|||::|.|:||. ..|...:|:..:....||:|..||:|..|..::||::|.|:...|..|..
  Rat   147 YGFDGLNLAWQYPG-CYGSPPKDKHLFTILTQEIRKAFEKEVSKNKKSRLIITAALAGVISPIQF 210

  Fly   207 GYDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGAD 271
            ||.||:|::.||:..|:|||.|.|.:.....::|||  :..:|....|..||.|::..:...|..
  Rat   211 GYHVPQLSQSLDYIQVMTYDLHGSWDGYTGENSPLY--KSPAETGVKAFYNIKYTMHNWKNKGVS 273

  Fly   272 RDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDD--PEWTVV 334
            .:||::|.|.||.::.|.:...||:|||:...|..|..|::.|:.||||||..||:.  ..|   
  Rat   274 PEKLIVGFPAYGHTFILSDSTKTEIGAPSNRGGHPGPYTKKTGFWAYYEICAFLKNGAIQVW--- 335

  Fly   335 QPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGT-CNGKPYPLIE 398
              ||....|||:..|:|||||:......||:::.....||.|.|||..||:.|: |:..|:||..
  Rat   336 --NAAQQVPYAFHGNEWVGYDNVKSFHIKAQWLKNNNFGGAMIWAIGMDDYTGSFCDQGPFPLTS 398

  Fly   399 AAKEAM 404
            ..|.|:
  Rat   399 TLKNAL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 129/353 (37%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 137/374 (37%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
RGD1309110XP_006233175.1 GH18_chitolectin_chitotriosidase 41..404 CDD:119351 137/374 (37%)
Glyco_18 43..382 CDD:214753 129/350 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.