DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-27

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:246 Identity:55/246 - (22%)
Similarity:105/246 - (42%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GGFTKDNQMKPFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERR-QQ 130
            |....|:..:.|.|.::..          |..:...|.:::|||  .::::|.|||.::.|| ::
 Worm   115 GSVEVDHSSRTFSKLKEKS----------KIESSHFKKLLSIGG--RSNTQFLPLVIADPRRKRR 167

  Fly   131 FIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTM 195
            |.|:|:..|.:...||:||.|::      .|:.:....::|:.||:.:. :|.:|.....:.:..
 Worm   168 FFKSIISILEEYQLDGVDLLWKW------AKNSNTKKCSRFLCELKQKL-KERKKNYVLSVQILP 225

  Fly   196 AVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSH-----EPSVNHHAPLYSLEEDS------- 248
            ..|:..|..:.....|        .|:...|.::..     |||   .:.|.|.|.:|       
 Worm   226 DEPSSWELFNPANGSP--------LNIQVEDCNTGPDTEVVEPS---DSELESTENNSKKLTVDI 279

  Fly   249 -EYNY---DAELNI--DYSIKYYLK----AGADRDKLVLGIPTYGRSYTLI 289
             ::.|   |..|..  :.::|.:||    |.::..||.|.....||:.|.:
 Worm   280 FKFCYITSDGNLQFEDEIAMKLFLKLKEQARSENLKLELIFKIDGRTNTFL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 55/246 (22%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 55/246 (22%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 30/131 (23%)
GH18_chitinase-like 97..>235 CDD:299167 32/138 (23%)
Glyco_hydro_18 261..>402 CDD:279094 18/73 (25%)
GH18_chitinase-like 268..>407 CDD:299167 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.