DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-25

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001300596.1 Gene:chil-25 / 188614 WormBaseID:WBGene00011846 Length:483 Species:Caenorhabditis elegans


Alignment Length:417 Identity:118/417 - (28%)
Similarity:178/417 - (42%) Gaps:104/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGGYAKFTGL 95
            |||.||:     |..|:|.....::.  .||.|:||.....|..:| |:| ||.|.    :|..|
 Worm   110 RVVGYYS-----RSETSKITSVQVSK--LTHAVFAFVYMNSDGTLK-FEK-QDEED----RFMQL 161

  Fly    96 KTY----NKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAH 156
            |..    ...:|.||:||| .|.|..|||::.|..|||.||.:||.||::|..|||||.||:|. 
 Worm   162 KDIVNMGTSPVKIMISIGG-KENSQNFSPVIESEYRRQIFINSILTFLKENDLDGIDLFWEWPC- 224

  Fly   157 REGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVP----AGIEYIDKGYDVPKLNKYL 217
                 |..:..|..|:.||:.:.:     |.....:|::.||    .|  :|| |:|:..:.:.:
 Worm   225 -----STYKSVYLHFICELKQQLQ-----TKDKDYILSIVVPPPEVGG--WID-GFDMNNIVQIV 276

  Fly   218 DWFNVLTYDFHSSHEPSVNHH-------APLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKL 275
            |:.||.:.|::.   |:.|..       ||:::.....|     ..|:|::.|.........:|.
 Worm   277 DFINVFSLDYYG---PTQNDFGKITGPTAPMFNGVPGRE-----TFNVDHTSKVLSCETMQSNKF 333

  Fly   276 VLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANV 340
            .:.||.|           |.|....:||.::.:..|....:....:.|:   .....:||....|
 Worm   334 NIAIPFY-----------TTLWENVQGPIDKIEIFRNVNKVHGKIVGQS---HMSRMIVQQKGFV 384

  Fly   341 MGPYAY---RRNQWVGYD-----------DEAIVRKKAEYVVAQGLGGIMFWAIDNDD------- 384
            :.||::   .||.:: |:           |::|| .|.|||....||||..|.:|.||       
 Worm   385 LTPYSFDNATRNAFI-YNSSTKIYLTFETDQSIV-AKIEYVSEHLLGGICIWTVDKDDEGNSQLN 447

  Fly   385 ---FRGTC-------------NGKPYP 395
               |.|.|             ||...|
 Worm   448 AISFDGLCTTGNVPKYDCSYWNGNTLP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 110/380 (29%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 117/416 (28%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-25NP_001300596.1 Glyco_18 110..439 CDD:214753 110/380 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.