DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and lmd-5

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001309512.1 Gene:lmd-5 / 187942 WormBaseID:WBGene00020141 Length:1518 Species:Caenorhabditis elegans


Alignment Length:409 Identity:111/409 - (27%)
Similarity:186/409 - (45%) Gaps:79/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGGYA 90
            ||...|:|.|||.|     |..:.....:..  .||:::||.....|..:| |......:.|..|
 Worm   986 ASCGKRIVGYYTGW-----GEREITENQLKK--LTHVIFAFVAMYADGSVK-FGPVSADDPGPQA 1042

  Fly    91 ------KFTGLK----TYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFD 145
                  :|..:|    ..|..::.:.|:|||:. |..||.:.|.:.:|:.|:.::..|:..:..|
 Worm  1043 GKKAERRFVDMKKKARAVNSGVRVLFAVGGWDN-SQYFSSVAADSGKRRNFVDSVASFIEHHKID 1106

  Fly   146 GIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGR-TRLLLTMAVPAGIEYIDKGYD 209
            |:|||||||..:.|    |:.|:...::|||..|...|.:..| ...|:|:|..||...:.:|||
 Worm  1107 GVDLDWEYPEMKGG----DKQNHVTLIRELRERFNGMASRNNRKDPYLITLASAAGEWNLREGYD 1167

  Fly   210 VPKLNKYLDWFNVLTYDFHSSHEPSVNHH----APLY--SLEEDSEYNYDAELNIDYSIKYYLKA 268
            :..:..|.|:.||:|||::.:.|.....:    ||||  ||:     .:..:||.|:|:|:|...
 Worm  1168 LKGILNYADFINVMTYDYYGAWESKWGAYTGTPAPLYFGSLK-----GFSGKLNADFSMKFYACN 1227

  Fly   269 GADRDKLVLGIPTYGRSYTLI------NEESTELGAPAEGPGEQG-----DATRE---KGYLAYY 319
            .....:|.:|:|.|||.:..:      ::......||..|..|.|     :..:|   ||...::
 Worm  1228 TKKPSQLTMGVPFYGRYWKNVLEPIDASDNMWRTAAPQNGKYEGGYVGWRNLEKEGWNKGSATWH 1292

  Fly   320 EICQTLKDDPEWTVVQPNANVMGPYAYRR--NQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDN 382
            :..:|                  ||....  ..::|:::|..:::|.:|...:.|||:|.||:|.
 Worm  1293 KKTKT------------------PYIMNNGARMFLGFENERSLKEKMDYATNRNLGGLMIWALDL 1339

  Fly   383 DD----------FRGTCNG 391
            ||          ..|.|:|
 Worm  1340 DDDADTLLNLVSSAGLCSG 1358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 104/384 (27%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 108/403 (27%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
lmd-5NP_001309512.1 LysM 22..65 CDD:197609
LysM 77..120 CDD:197609
LysM 151..194 CDD:197609
LysM 220..260 CDD:197609
LysM 275..312 CDD:197609
LysM 386..429 CDD:197609
Self-incomp_S1 851..944 CDD:283566
Glyco_18 991..1336 CDD:214753 101/380 (27%)
GH18_chitinase-like 992..1336 CDD:299167 100/379 (26%)
ChtBD1_GH18_2 1388..1435 CDD:211315
ChtBD1_GH18_2 1462..1513 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.