DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and R09D1.14

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496028.1 Gene:R09D1.14 / 187741 WormBaseID:WBGene00011170 Length:150 Species:Caenorhabditis elegans


Alignment Length:123 Identity:38/123 - (30%)
Similarity:61/123 - (49%) Gaps:22/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGGYAK--FT 93
            |::.||     :...|:......::.  .||.|:||...|.|.|::        ..|..||  ||
 Worm    44 RIIGYY-----FATQTSVITSDQVSN--LTHAVFAFVNITSDGQLQ--------IDGDLAKNRFT 93

  Fly    94 GL----KTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGI 147
            .|    |....|:|.||:||| |:.|:.|.|:::|.:|::.||.:.:.||:....||:
 Worm    94 NLIEIAKQQTPQVKVMISIGG-NDNSNNFKPVLSSPDRKKLFINSTVSFLQTYDIDGV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 38/123 (31%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 37/122 (30%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
R09D1.14NP_496028.1 Glyco_18 44..>150 CDD:214753 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.