DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-17

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans


Alignment Length:427 Identity:105/427 - (24%)
Similarity:189/427 - (44%) Gaps:90/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFLLCAL-AYCI---------------NEAS----SEGRVVCYYTNW---SVYRPGTAKFNPQNI 54
            :||.|.: :|.:               ||..    .:.|:|.||:.:   .:.:...||.     
 Worm    39 IFLFCGIVSYALTTFVFHFYKEDKFSKNEVGLDPICKRRIVGYYSEYDSTDISKNQLAKL----- 98

  Fly    55 NPYLCTHLVYAFGGFTKDNQMKPFDKYQDI--EQGGYAKFTGLK----TYNKQLKTMIAIGGWNE 113
                 ||.|:||.....|..:    :::::  ||    ||..||    :.:..||.|.:||| :|
 Worm    99 -----THAVFAFVDIKYDGTL----QFKNLITEQ----KFFSLKSKARSLHSNLKLMFSIGG-DE 149

  Fly   114 ASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAE 178
            .|..||..:|:.:.:...|.:|:.|:..:..||:||.|::|.      |||:.|||..::|:|  
 Worm   150 NSFDFSSALANTQMKSTLITSIIAFIHSHMIDGVDLHWKWPT------SRDKSNYATLIREIR-- 206

  Fly   179 FEREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNH----HA 239
             |:..|...:..:.:|:. |.|:...:.|:|:..:.|::|:.||.:.|:   .:|..|.    ..
 Worm   207 -EKVDELDAKIIISITIP-PVGVSDWESGFDLDAIQKHVDFINVHSMDY---AKPLPNQWGTPTG 266

  Fly   240 PLYSLEEDSEYNYDAEL----NIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLIN---EESTELG 297
            |..|:      |::..|    |:|:::|:|.........:.|.||.|.|.:..:.   :..||:.
 Worm   267 PSASM------NFNIGLRQHYNVDWTMKHYTCELKKPSMINLVIPFYVRMWKNVQKAIDNRTEVF 325

  Fly   298 APAEGPGEQGDATREKGYLAYYEI-CQTLKDDPE-WTVVQPNANVMGPYA--YRRNQWVGYDDEA 358
            ...|   .:.:....:..|:.|.: .:.::..|| |    .|| ...||.  .:...:..|::|.
 Worm   326 RNVE---LKDNEVEGRSQLSRYTVEHEDMELSPESW----DNA-TQTPYVLDLKTRTFFTYENEK 382

  Fly   359 IVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYP 395
            .::.|.:||....|||:..|::|.||...|.....:|
 Worm   383 SIKVKLDYVNKMDLGGVWIWSVDMDDRLNTLLSFVFP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 95/375 (25%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 98/388 (25%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 95/375 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.