DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-12

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_506770.2 Gene:chil-12 / 187357 WormBaseID:WBGene00010799 Length:450 Species:Caenorhabditis elegans


Alignment Length:389 Identity:97/389 - (24%)
Similarity:164/389 - (42%) Gaps:84/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EASSEGRVVCYYTNWSVYRPGTAKFNPQNINPY-LCTHLVYAFGGFTKDNQMKPFDKYQDIEQGG 88
            |.:...|::.||:       ||:. :...||.. ..||.::||...|.|..:...:|        
 Worm    88 ENTCSKRIIGYYS-------GTSD-SEITINQVSKLTHAIFAFVQLTFDGTLVFRNK-------- 136

  Fly    89 YAKFTGL----KTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDL 149
             .:|..|    ||.|..:|.|.:|||... |..|||:|.:.|::::|||:|..||.::..||:|:
 Worm   137 -NRFMALRNIAKTENSTVKFMFSIGGPGH-SQNFSPVVRNQEKKRRFIKSIFSFLEEHKLDGVDI 199

  Fly   150 DWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLN 214
            .|::|      ...|:..|:||:.||     .|..||.:..:|..:..|.||.:. .|:.:.::.
 Worm   200 FWKWP------HLADKHAYSQFLLEL-----NEILKTRKDYILSILVPPQGIGFA-SGFKMNEIV 252

  Fly   215 KYLDWFNVLTYDFH----SSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKL 275
            :.:|:.|:...|::    |.........:|:|...|..|     :.|:|.:...|........|.
 Worm   253 ENVDFINIFAMDYYGPWASGWGNPTGPISPIYGGSERRE-----QWNVDNTAAIYSCETMRSSKF 312

  Fly   276 VLGIPTYGRSYTLINEESTELGAPAEGPGEQ---------GDATRE----------KGY-LAYYE 320
            .:.||.:.|.:       ..:|.|.:.||::         |.|..|          ||| |:.|.
 Worm   313 NIVIPFFARLW-------NNVGKPIDFPGKEVYRNVTLIDGKAVGEVYMPRRSALQKGYNLSSYN 370

  Fly   321 ICQTLKDDPEWTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDD 384
            .     ||...|....|:..        .:::.::.:..:..|.:||....|||:..|.:|.||
 Worm   371 Y-----DDLSETAFIYNSTT--------KEYLTFEVKRSIAAKLDYVQNMNLGGVWIWQMDMDD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 94/380 (25%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 95/382 (25%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-12NP_506770.2 Glyco_18 94..420 CDD:214753 94/380 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.