DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-7

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:408 Identity:93/408 - (22%)
Similarity:166/408 - (40%) Gaps:100/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASSEGRVVCYYTNWSVYRPGTAKFNPQNINP---YLCTHLVYAFGGFTKDNQMKPFDKYQDIEQG 87
            |....|:|.|||:|          .|:.|:.   ...|||:     ||.          ..:...
 Worm   122 AKCNKRIVGYYTDW----------EPRKISAKQLQKLTHLI-----FTN----------VPMNSS 161

  Fly    88 GYAKFTGL-----------KTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQ 141
            |:..|..|           |.....:|.|.:|||...| ..:|.:||.:.:|..||.:|:.|::.
 Worm   162 GHVFFENLAQRRRFLEINRKAQLMNVKVMFSIGGHKNA-EHYSTVVADSTKRSVFIDSIVSFIKS 225

  Fly   142 NHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFE--REAEKTGRTRLLLTMAVPAGIEYI 204
            |:..|:||.||:|      ...:.:::...::|||.:..  .:|:..| ||.||::.||:....:
 Worm   226 NNASGVDLFWEWP------NISEMNDFITTIKELRKKLAALTKAQPKG-TRYLLSIIVPSSPSDL 283

  Fly   205 DKGYDVPKLNKYLDWFNVLTYDFHSS----HEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYY 265
            :....:..|..|:|:.|||||.:::.    :...|..:||||....:         |:|.:::|.
 Worm   284 EYYLRMDGLLHYVDFLNVLTYGYYAPWSGVNGKFVGPNAPLYGGNRE---------NVDETMQYL 339

  Fly   266 LKAGADRDKLVLGIPTYGRSYTLINE--------ESTELGAPAEGPGEQGDATREKGYLAYYEIC 322
            :.......||.:.:..|||.:..:|:        |:..:...|:|.           ::|:..:.
 Worm   340 ICKTRTPSKLNMALSFYGRYWENVNDNVPDEMFKEADLINGKAQGM-----------FVAWKNLA 393

  Fly   323 QTLKDDPE--WTVVQPNANVMGPYAY--RRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDND 383
            ....|..|  |     :.....||.:  ...::..:::|..::.|.:|.....:||:..||:..|
 Worm   394 GRGWDKSEALW-----HEETQIPYIWNSEERKFFVFENERSLQAKMDYAADHNIGGVYIWALGAD 453

  Fly   384 DFRGT----------CNG 391
            |...|          |.|
 Worm   454 DNNDTLLNVVSSADLCEG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 87/383 (23%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 91/402 (23%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 87/383 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.