DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-4

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496125.1 Gene:chil-4 / 182434 WormBaseID:WBGene00007469 Length:457 Species:Caenorhabditis elegans


Alignment Length:371 Identity:94/371 - (25%)
Similarity:156/371 - (42%) Gaps:69/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGG---YAKF 92
            |:|.|:..:.    .||....|   ..:.||::|.|.          ..|..::..||   ..||
 Worm   111 RIVGYFAEFE----NTALTRKQ---LQMLTHIIYLFA----------IPKNGNMTFGGERSRRKF 158

  Fly    93 TGLKT----YNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEY 153
            ..:|.    .|..||.||:|||.:.:.| ||.||::...|..|:.:|:.|:::...|||::.|.:
 Worm   159 EEMKNEARKANSTLKVMISIGGQSNSRS-FSRLVSNETSRNVFVNSIVSFVQKYDIDGIEIFWTW 222

  Fly   154 PAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTR-LLLTMAVPAGIEYIDKGYDVPKLNKYL 217
            |      |..|.:||..|:||||..|....:|..|.. .::::.|..   |.::..::...:|::
 Worm   223 P------KYEDANNYLIFIQELRYAFIELQKKLNRKEDYVISIIVNC---YDNQLSNLMGFSKFV 278

  Fly   218 DWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTY 282
            |:||:.:..:.|.   .|...:|||.         ....|||.::|||:.......|..:.:..:
 Worm   279 DFFNIYSIHYQSR---QVGPSSPLYG---------GGSRNIDETMKYYICRTGQPSKFNMMVLFH 331

  Fly   283 GRSYTLINEESTELGAPAEGPGEQGDATREKGYLA--YYEICQTLKDDPEWTVVQPNANVMGPYA 345
            |..:     :..||....:......|....||..|  :.|:.|     .:|.:.....:.:...:
 Worm   332 GTFW-----KGAELPLRNDSDDIFKDQNSAKGGFAVRWRELLQ-----QKWDMSNIKFHNLTKTS 386

  Fly   346 YRRNQWV-------GYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDD 384
            |   .|:       ..:||..:|.|..||....:|||..|.||.||
 Worm   387 Y---MWIPGSSLFLTLEDEQSLRVKNRYVADHNIGGITMWTIDQDD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 92/368 (25%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 93/370 (25%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-4NP_496125.1 Glyco_18 111..428 CDD:214753 92/368 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.