DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-2

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:397 Identity:84/397 - (21%)
Similarity:170/397 - (42%) Gaps:96/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVCYYTNWSV--YRPGTAKFNPQNIN---------PYLCTHLVYAFGG-FTKDNQMKPFDKY--- 81
            :|.|..:.:|  |...:..|....||         .:.|...|.|:.. |..::|:|....:   
 Worm     1 MVAYGLSSAVLFYLEDSEAFETNEINYEYSSKLMANFKCQKRVVAYSAKFLSNHQLKKLTHFIFT 65

  Fly    82 -QDIEQGGYAKFTGLKTY----------NKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNI 135
             ..|...|..|:...:.:          |..||.|:.|.|      :|..::|.:|::..|||:|
 Worm    66 SISIFPNGTIKWPNCENFESYARKAKMDNPNLKIMVEING------KFFSVLAEDEKKNSFIKSI 124

  Fly   136 LKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAG 200
            ..|:..:.|||:|:.|.:|        .|.|.:..|::|.|.:.|:        .:::::|:|..
 Worm   125 SSFVVDHKFDGVDIFWSWP--------EDEDTFHLFIKEFREKLEK--------HMIISIAIPRL 173

  Fly   201 IEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEP------SVNHHAPLYSLEEDSEYNYDAELNID 259
            .:.:: |:::..|..::|:.|||:.::   :||      ::...:|||..:..         |:|
 Worm   174 AQQLE-GFNLKLLMNHIDFLNVLSINY---YEPLPGNGANIGPISPLYGGQRG---------NVD 225

  Fly   260 YSIKYYLKAGADRDKLVLGIPTYGRSYTLINE---ESTELGAPAE---GPGEQGDATREKGYLAY 318
            .::||..........|.:|:...|..:..:.:   |..::...|:   |||      :..|:..:
 Worm   226 GTLKYLTCITKRPSILNMGVTFTGIFWNGVKDGLNEQDDIWKVAQNENGPG------KSIGWRKF 284

  Fly   319 YEICQTLKDD----PEWTVVQPNANVMGPYAY--RRNQWVGYDDEAIVRKKAEYVVAQGLGGIMF 377
                  :||.    |:|     :.:....||:  :...::.:::|..:.:|..||..:.:||::.
 Worm   285 ------IKDRRNTIPQW-----HDSSKSSYAWDPKSKIFLAFENEKSLSEKVIYVRNKNIGGLVI 338

  Fly   378 WAIDNDD 384
            |.:|.||
 Worm   339 WNVDQDD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 82/394 (21%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 84/397 (21%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 74/353 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.