DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-13

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_496018.2 Gene:chil-13 / 174500 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans


Alignment Length:413 Identity:98/413 - (23%)
Similarity:186/413 - (45%) Gaps:82/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFLLCAL-------AYC----------INEAS-----SEGRVVCYYTNWSVYRPGTAKFNPQNIN 55
            :.::|.|       .||          :|..|     .:.|:|.|::...     :.:.:...|:
 Worm    41 VLMICGLIAFGITEIYCRLFPVTDNLVLNNESPKKPVCKRRIVGYFSEIE-----STEISKSQID 100

  Fly    56 PYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGGYAKFTGL--KTYNKQLKTMIAIGGWNEASSRF 118
            .  .||.|:||.....|..::..:...|:      :|:.|  ||....::.|::|||..|.:..|
 Worm   101 K--LTHAVFAFVRIKYDGTLQFDNSKADL------RFSILKDKTRGSNVEMMVSIGGGYENAHYF 157

  Fly   119 SPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREA 183
            :..::.:::::.||.:||.||.::..||:|..|::|.      .:|..||..|::|||    ::.
 Worm   158 ASALSDSQKKKNFIDSILAFLVEHRIDGVDFFWQWPT------VQDTFNYVTFIRELR----QKL 212

  Fly   184 EKTGRTRLLLTMAVP-AGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNH-------HAP 240
            ::..|...|::|.|| ||::..:.|:|:.:|..::|:|||.:.|:..   |..|.       .:|
 Worm   213 DENKRKHFLISMTVPAAGVDNWELGFDLEELQNHVDFFNVYSMDYAG---PWPNQWGVPTGPSSP 274

  Fly   241 LYSLEEDSEYNYDAELN--IDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINE---ESTELGAPA 300
            ::       ||..|..|  :|:::|:|.........|.:.||...|.:..:.|   ..||:...|
 Worm   275 MF-------YNIGARKNFYVDWTMKHYTCKLKQPSMLNMVIPFSARIWNNVQEAIDNRTEVFRNA 332

  Fly   301 EGPGEQGDA-TREKGYLAYYEICQTLKDDP-EWTVVQPNANVMGPYA--YRRNQWVGYDDEAIVR 361
            |......:. |:...:.|.:|   .|:..| .|..:     .|.||.  .:...::.::|:..::
 Worm   333 ELKNNMAEGRTQISRWTAEHE---GLELSPSSWDNL-----TMTPYILDLKAKTFLTFEDKRSIK 389

  Fly   362 KKAEYVVAQGLGGIMFWAIDNDD 384
            .|.:|.....|||:..|::|.||
 Worm   390 IKTDYAKKMDLGGVWLWSVDMDD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 90/370 (24%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 91/372 (24%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 90/370 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.