DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and btb-17

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 / 173673 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans


Alignment Length:184 Identity:37/184 - (20%)
Similarity:64/184 - (34%) Gaps:52/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  3917 ETETENVTEI-----------------ETATNANEAT-----SINSQDQTISSTTQAP--PPATT 3957
            |...|::.||                 :|..|.|..|     |:....||::...:.|  |.|..
 Worm    71 EAGNEDIDEIAGTIDVKFRRNQVSGMFQTGQNQNFTTVHTLVSLTEHCQTLTKLVEVPNQPGAVE 135

  Fly  3958 LLHVFTL------LEGEGQEEEPTTRKPTVRLYPTIQTEVVPKHKLIEINR------------IV 4004
            :::|:.|      |:....|...:::|....|       |:.:.|| .:|:            :.
 Worm   136 VMYVYALVPWINPLQFSFDEMFLSSKKNDAVL-------VIGERKL-HVNKAFLSYHSDYFRALF 192

  Fly  4005 EINSKQAK--AAQRKSKANHDFSTLMVESLPHVEQLGEISVVKYVHLVDGSDIQ 4056
            ..|.|:.|  ..:.|.....||..||....|..|...:.:..|.:.:.|...:|
 Worm   193 SSNFKEDKQDEIELKDVVYEDFGLLMTTIYPKTEFPSDRTAEKILEMADRFMVQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753
GH18_chitolectin_chitotriosidase 32..404 CDD:119351
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
btb-17NP_872000.1 BTB 164..260 CDD:197585 18/91 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.