DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and chil-24

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_494455.1 Gene:chil-24 / 173661 WormBaseID:WBGene00020407 Length:410 Species:Caenorhabditis elegans


Alignment Length:431 Identity:98/431 - (22%)
Similarity:186/431 - (43%) Gaps:105/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NEA-SSEGRVVCYYTNW---SVYRPGTAKFNPQNINPYLCTHLVYAFG--------GFTKDNQMK 76
            ||. ::..|:|.:|.:|   .:.....||.          ||.|:|:.        ||..|....
 Worm    47 NETETTPSRIVGFYADWERTDITSHQVAKL----------THAVFAYVQMKFDGSLGFKNDAARI 101

  Fly    77 PFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQ 141
            .|...:|..:         :..:..:|.||:|||: |.|..|.|::::.|.::.|:.:|..||..
 Worm   102 RFSNLRDKVR---------RNEDSNVKMMISIGGF-ENSQHFYPVLSNVEMKKAFLNSISSFLAY 156

  Fly   142 NHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVP-AGIEYID 205
            :...|:|:.|::|:      ..|:.:|::|:.:||.....|        .::::||| |.:..::
 Worm   157 HELHGVDIFWKWPS------PEDKAHYSRFLADLRQHLGYE--------FIISVAVPQAEVSNLE 207

  Fly   206 KGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNHH-------APLYSLEEDSEYNYDAELNIDYSIK 263
            .|||:..::.::|:|||.:.|::.   |..|..       :|||.         ....|:|::::
 Worm   208 LGYDLRTISSHVDFFNVHSMDYYG---PWPNEWGKPTGPISPLYG---------PTRHNVDWTLR 260

  Fly   264 YYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGE-------------QGDATREKGY 315
            ||.:...:..||.:.||.:.|.:..:.|       |.| ||.             ||:|...:..
 Worm   261 YYAEKTGEPGKLNMVIPFFVRLWKNVPE-------PVE-PGRQVFRDVELVDNKPQGEAYMSRWS 317

  Fly   316 LAYYEICQTLKDDPEWTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAI 380
            ..:.|:..:..|   |.....::....|..  || :|.::.:..:::|.:||..:.|||:..|.:
 Worm   318 AQHEELDLSPAD---WDEETRSSYTWNPDT--RN-FVTFETDKSIQEKMKYVKEKNLGGVWIWHV 376

  Fly   381 DNDDFRGTCNGKPYPLIEAAKEAMVE-----ALGLGINEVA 416
            |       .|.|....:....|.:|:     .:||.|:.::
 Worm   377 D-------ANEKLLDSVRFDGEGVVDDQEYREIGLDISSLS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 89/383 (23%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 91/403 (23%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
chil-24NP_494455.1 Glyco_18 55..378 CDD:214753 89/389 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.