Sequence 1: | NP_001245598.1 | Gene: | Cht6 / 31935 | FlyBaseID: | FBgn0263132 | Length: | 4611 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254213.1 | Gene: | T19H5.6 / 13186491 | WormBaseID: | WBGene00044807 | Length: | 286 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 63/203 - (31%) |
---|---|---|---|
Similarity: | 95/203 - (46%) | Gaps: | 38/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 EGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAF-----GG---FTKDNQMKPFDKYQDIE 85
Fly 86 QGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLD 150
Fly 151 WEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAV-PAGIEYIDKGYDVPKLN 214
Fly 215 KYLDWFNV 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht6 | NP_001245598.1 | Glyco_18 | 31..383 | CDD:214753 | 62/201 (31%) |
GH18_chitolectin_chitotriosidase | 32..404 | CDD:119351 | 61/200 (31%) | ||
CBM_14 | 506..562 | CDD:279884 | |||
Oxidored_q2 | <2691..2750 | CDD:294335 | |||
CBM_14 | 4554..4609 | CDD:279884 | |||
T19H5.6 | NP_001254213.1 | Glyco_18 | 69..>255 | CDD:214753 | 62/201 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1289629at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |