DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dna2 and Ct55

DIOPT Version :10

Sequence 1:NP_727386.1 Gene:Dna2 / 31934 FlyBaseID:FBgn0288690 Length:1100 Species:Drosophila melanogaster
Sequence 2:NP_083418.1 Gene:Ct55 / 75013 MGIID:1922263 Length:236 Species:Mus musculus


Alignment Length:110 Identity:25/110 - (22%)
Similarity:47/110 - (42%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 KEGLLREVASGRNEQRDL--------LMLRNDLAYWLTREVAIPASKEDPLEQLP-LPEPVYHHS 404
            ::.||.:..|.:|:|..:        .|.::      ||..|...:.::||:..| ||..|...|
Mouse    25 RQKLLEDATSLQNKQGVVAGSCSNYDCMTKH------TRSSADVETGDNPLKAEPNLPAAVEEQS 83

  Fly   405 ACGNCAYNTICSSFAQKDSSLQLSDSHPLKKLMPQLLEHLSEADH 449
            ..|   .|.:.   ...|...:.|:|| ::.|:..:...:.:||:
Mouse    84 PRG---LNAVT---VDNDHDEEPSESH-MRILLASITSLVGDADY 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dna2NP_727386.1 DNA2_N-like 153..378 CDD:411722 6/36 (17%)
DEXXQc_DNA2 636..836 CDD:350799
AAA_12 815..1055 CDD:463780
Ct55NP_083418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..84 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.