DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2990 and LOC100360296

DIOPT Version :9

Sequence 1:NP_727386.1 Gene:CG2990 / 31934 FlyBaseID:FBgn0030170 Length:1100 Species:Drosophila melanogaster
Sequence 2:XP_008771545.2 Gene:LOC100360296 / 100360296 RGDID:2322455 Length:239 Species:Rattus norvegicus


Alignment Length:186 Identity:32/186 - (17%)
Similarity:72/186 - (38%) Gaps:51/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 LKLVKGQEV--ILEEGRYRQTLELGEEADPSRDLSLSGFDLGEYVVISSTSRLAVAAGFIVSIEA 555
            |.||:..||  .|:..:.:...:|.|.::||:        ||:        ||.:.....|:.| 
  Rat    73 LALVEQDEVTHTLKTIKVKVMTDLPEGSEPSK--------LGK--------RLCIRCVTSVTEE- 120

  Fly   556 RRLDLRLERDLS----------QRYSEETFIIDKHDSQSFATFNFTNLGMLLSEGERFQELRDII 610
               |:.:..|:|          :.:..:..:::...:...:..|..::..|     ..|::.::.
  Rat   121 ---DVYISEDVSFPLYLFSGAFKPFKGDLVLVEYSMNSGMSNINIHSVSPL-----SCQDINEVY 177

  Fly   611 VAKKPPEQHKVLPKIILTKGA--------PIL------LNLNKVQQNAALRALTTS 652
            |.........|..::..|..:        |.|      :.::.:||:.:|||::.:
  Rat   178 VTSIDGRNGMVEARVFFTLDSLQIPSGYTPGLYDIVDVVTVDSIQQHCSLRAVSVT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2990NP_727386.1 Dna2 99..297 CDD:285859
Cas4_I-A_I-B_I-C_I-D_II-B <283..415 CDD:294426
TIGR00376 480..1069 CDD:273041 32/186 (17%)
P-loop_NTPase 636..859 CDD:304359 5/17 (29%)
AAA_12 815..1055 CDD:289832
LOC100360296XP_008771545.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.