DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and angptl1a

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001014820.1 Gene:angptl1a / 544656 ZFINID:ZDB-GENE-040724-269 Length:480 Species:Danio rerio


Alignment Length:191 Identity:75/191 - (39%)
Similarity:106/191 - (55%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 FCDQKVRNGGWTMVVNRYDGSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYELLVQLQ 214
            :|:.|:.|||||:...|.|||.:|.|.|.:||.|||.:..|.::||:.::.:....:|:|||:|:
Zfish   297 WCEHKLDNGGWTVFQRRKDGSVNFFRNWENYKKGFGNIDGEHWLGLENIYNLAKQGDYKLLVELE 361

  Fly   215 NRKQELRYALYDHFSIGSESEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDENEQNCAAQQ 279
            :...:..||.|..|.:..|||.:||. ||.|.|:|.|:|..|.||.|:|.||..|....|||...
Zfish   362 DWVGKKVYAEYSSFHLEPESEGFRLR-LGTYQGNAGDSLTSHNGKPFTTLDRDKDAFTGNCAHFH 425

  Fly   280 SGAFWYGGSCNLTN------PFGLYQRLLERDVDGFKGILWRGFLNGPKGSLKIVRMMVRP 334
            .|.:|| .:|..||      ..|:|:...:      .||.|..: .|...|||.||||:||
Zfish   426 KGGWWY-NACGQTNLNGVWYSGGVYRSKFQ------DGIFWAEY-GGGYYSLKSVRMMIRP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 75/191 (39%)
angptl1aNP_001014820.1 FReD 264..479 CDD:238040 75/191 (39%)

Return to query results.
Submit another query.