DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and CG31832

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:197 Identity:81/197 - (41%)
Similarity:111/197 - (56%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EPFFVF-CDQKVRNGGWTMVVNRYDGSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYE 208
            |||.|. |....|:  |.::..|.|||.:||:.|..||.|||....||||||.||:.:|....:|
  Fly    42 EPFQVTQCKTTARD--WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHE 104

  Fly   209 LLVQLQNRKQELRYALYDHFSIGSESEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDENEQ 273
            |.:||::......||.:|.|.:.||:|.|:|..:|.|.|.|.|:||.|..|:|||.||.|||:.:
  Fly   105 LFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSK 169

  Fly   274 NCAAQQSGAFWYGGSCNLTNPFGLYQRLLERDVDGFKGILWRGFLNGPKG-----SLKIVRMMVR 333
            ||||:..|.:|: .||..::..|||.|  |.:.....||.|        |     ||..|::|:|
  Fly   170 NCAAEHGGGWWF-HSCLSSSLNGLYFR--EGETGMLNGIHW--------GRWKFQSLTFVQIMIR 223

  Fly   334 PR 335
            |:
  Fly   224 PK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 80/195 (41%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/195 (41%)

Return to query results.
Submit another query.