DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and FGG

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:313 Identity:90/313 - (28%)
Similarity:140/313 - (44%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SALSGLTTRMQSLNNEIASVKEQIGSLQEQLVDLRRAGSAPVVGLASPNALASRFPFSHNSLDIE 109
            |::..|.....|.|.:|.::||::..|:.|..:       |......          .|:....:
Human   131 SSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQE-------PCKDTVQ----------IHDITGKD 178

  Fly   110 PQLLANGGAAAVPITPANCLKQQHGVVRIRPRSNVEPFFVFCDQKVRNGGWTMVVNRYDGSEDFN 174
            .|.:||.||            :|.|:..|:|....:.|.|:|:......|||:...|.|||.||.
Human   179 CQDIANKGA------------KQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFK 231

  Fly   175 RKWADYKIGFGPL----TTEFFIGLDKLHQIT--SSDNYELLVQLQNRKQELRYALYDHFSIGSE 233
            :.|..||.|||.|    ||||::|.:|:|.|:  |:..|.|.|:|::.......|.|..|.:|.|
Human   232 KNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPE 296

  Fly   234 SEQYRLNVLGDYHGDAADA--------------LRDHTGKKFSTHDRVNDENEQNCAAQQSGAFW 284
            :::|||.......|||.||              ...|.|.:|||.|..||:.|.|| |:|.|:.|
Human   297 ADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC-AEQDGSGW 360

  Fly   285 YGGSCNLTNPFGLYQR----LLERDVDGF-KGILW----RGFLNGPKGSLKIV 328
            :...|:..:..|:|.:    ......:|: .||:|    ..:.:..|.::||:
Human   361 WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKII 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 74/235 (31%)
FGGNP_068656.2 Fib_alpha 30..172 CDD:462570 10/57 (18%)
Fibrinogen_C 175..414 CDD:395095 79/252 (31%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 3/14 (21%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.