DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and FCN1

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens


Alignment Length:220 Identity:81/220 - (36%)
Similarity:109/220 - (49%) Gaps:19/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PANC---------LKQQHGVVRIRPRSNVEPFFVFCDQKVRNGGWTMVVNRYDGSEDFNRKWADY 180
            |.||         |...|.:.    ..:..|..|.||.....||||:...|.|||.||.|.||.|
Human   115 PRNCKDLLDRGYFLSGWHTIY----LPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAY 175

  Fly   181 KIGFGPLTTEFFIGLDKLHQITSSDNYELLVQLQNRKQELRYALYDHFSIGSESEQYRLNVLGDY 245
            |.|||....||::|.|.:|.:|:..:.||.|.|.:.:...::|.|..|.:..|:|:|:| |||.:
Human   176 KQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKL-VLGAF 239

  Fly   246 -HGDAADALRDHTGKKFSTHDRVNDENEQNCAAQQSGAFWYGGSCNLTNPFGLYQRLLERDVDGF 309
             .|.|.::|..|....|||.|:.||.:..|||.:..||:|| ..|:.:|..|||  |:.......
Human   240 VGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY-ADCHASNLNGLY--LMGPHESYA 301

  Fly   310 KGILWRGFLNGPKGSLKIVRMMVRP 334
            .||.|.. ..|.|.|.|:..|.|||
Human   302 NGINWSA-AKGYKYSYKVSEMKVRP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 81/220 (37%)
FCN1NP_001994.2 Collagen 52..107 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111
FReD 115..325 CDD:238040 79/218 (36%)
A domain, contributes to trimerization 115..154 9/42 (21%)
B domain, contributes to trimerization 155..243 36/88 (41%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.