DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and Fcna

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:125 Identity:26/125 - (20%)
Similarity:49/125 - (39%) Gaps:19/125 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CMSDSYYEIEEGPKISDPNPHINLGKNYQARVK--------KWCDRQVSTSERDAIEDRDEIVFS 168
            |.:.|.:..|:..:|...|.|..|......::|        :|   ...||.|:.:....|.|  
Mouse   160 CGAFSQHHFEKRSRIITANAHAILSGTVYRKIKTLSLSHSSRW---HSDTSHREDMLGEAERV-- 219

  Fly   169 SEILQDI-----DPEQITAFELLACSQACPRAGRNKELALHLLMENKGNIEAAVEDLLRS 223
            :|::..:     .|.::|.:..|..::..|.......|.| :|:..|..:|...:.|.|:
Mouse   220 AELVVTLACIWSSPLRVTLYLGLLWAKLGPSVLVGVTLLL-VLIPVKSAVERKAKQLRRT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 23/114 (20%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117
Collagen 67..106 CDD:460189
FReD 123..332 CDD:238040 26/125 (21%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 1/1 (100%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 18/92 (20%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.