DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1889 and LOC100485381

DIOPT Version :10

Sequence 1:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_031746654.1 Gene:LOC100485381 / 100485381 XenbaseID:XB-GENE-29077791 Length:319 Species:Xenopus tropicalis


Alignment Length:226 Identity:82/226 - (36%)
Similarity:113/226 - (50%) Gaps:20/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VPITPANCLK--QQHGVVR-----IRPRSNVEPFFVFCDQKVRNGGWTMVVNRYDGSEDFNRKWA 178
            ||.|..||.:  .|.|.:.     ..|..  .|..|.||.:...|||.:...|.|||.||.|.|.
 Frog   102 VPGTAQNCKEWLDQGGTISGWYTIYTPYG--LPLSVLCDMETDGGGWIVFQRRADGSVDFYRDWN 164

  Fly   179 DYKIGFGPLTTEFFIGLDKLHQITSSDNYELLVQLQNRKQELRYALYDHFSIGSESEQYRLNVLG 243
            .||.|||...:||::|.|.||.:|::.|::|.|.|.:..::..||.|.:|.|..|::.|.|::.|
 Frog   165 SYKRGFGHKESEFWLGNDNLHLLTATGNFQLRVDLTDFSEQRTYAAYSNFRIAGEAQNYTLSLGG 229

  Fly   244 DYHGDAADALRDHTGKKFSTHDRVNDEN-EQNCAAQQSGAFWYGGSCNLTNPFGLYQRLLERDVD 307
            ...|||.|:|..|.|..||:.||.||.: ..:||....||:|| ..|:.:|..|||  |......
 Frog   230 FTGGDAGDSLSGHNGYSFSSKDRDNDVHLTGSCAQSYKGAWWY-TKCHGSNLNGLY--LGGNHTS 291

  Fly   308 GFKGILWRGFLNGPKG---SLKIVRMMVRPR 335
            ...|:.|    :..||   |.|:..|..||:
 Frog   292 YANGVNW----SAGKGYHYSYKVSEMKFRPQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1889NP_727376.2 FReD 123..335 CDD:238040 79/222 (36%)
LOC100485381XP_031746654.1 Collagen 45..101 CDD:460189
FReD 107..317 CDD:238040 77/218 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.