DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fgg

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001304034.1 Gene:Fgg / 99571 MGIID:95526 Length:443 Species:Mus musculus


Alignment Length:278 Identity:80/278 - (28%)
Similarity:123/278 - (44%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTPRNCYD----- 126
            ::.|||.::.:|:...:|                |...|||..        |.|.::|.:     
Mouse   145 KITNLKQKVAQLEAQCQE----------------PCKDSVQIH--------DTTGKDCQEIANKG 185

  Fly   127 -EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALN----SE 186
             ::.|...||.....:.|...|:......||.|:..|.|||.||.|:|..||.|||.|:    :|
Mouse   186 AKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKRIDGSLDFKKNWIQYKEGFGHLSPTGTTE 250

  Fly   187 FFIGLDKLHRLT--NSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLL---YVLGAYKGDAG 246
            |::|.:|:|.::  ::..:.|.|.:|..:|....|.|..|.:|.||:||.|   |.:|...|||.
Mouse   251 FWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAF 315

  Fly   247 DSLRY-----------HAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ----- 295
            |...:           |.|.:|:|:|.|||....|||......||..: |...:|.|.:.     
Mouse   316 DGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNK-CHAGHLNGVYHQGGTY 379

  Fly   296 SKYGQEIGYFKGILWKSF 313
            ||.....|:..||:|.::
Mouse   380 SKSSTTNGFDDGIIWATW 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 70/226 (31%)
FggNP_001304034.1 Fib_alpha 30..171 CDD:285864 9/41 (22%)
FReD 174..413 CDD:294064 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.