DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:349 Identity:104/349 - (29%)
Similarity:163/349 - (46%) Gaps:80/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAGLAARVQFMTDELQNLKTELNELQ-----------------GLIEE-----YKNQGTGI--PI 94
            |:.|..::..:|.|:..:.|...||:                 .|:||     :..|.|.:  |:
Human   151 LSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPL 215

  Fly    95 ATRLLRPLPASVQ---------------TFPLALATPPD-------------------DTP-RNC 124
            ...:.:.:|.|.|               .:|..|..|||                   :.| ::|
Human   216 VQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDC 280

  Fly   125 YDEKH------GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGAL 183
            ...|.      |...|:......|....|:..:..|||.||..|.|||.:|.::|:|||.|||.:
Human   281 QQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNI 345

  Fly   184 NSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDS 248
            :.|:::||:.::.|:|.::::|||.::..|.::.:|.|..|.:..|||.|.|. ||.|:|:||||
Human   346 DGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLR-LGTYQGNAGDS 409

  Fly   249 LRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGT------FQSKYGQEIGYFKG 307
            :.:|.||:|||.|:|.|....|||..|.|.||| ..|..|||.|.      ::||:..      |
Human   410 MMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWY-NACAHSNLNGVWYRGGHYRSKHQD------G 467

  Fly   308 ILWKSFLPGPTGSLSYVRMLIRPL 331
            |.|..: .|.:.||..|:|:|:|:
Human   468 IFWAEY-RGGSYSLRAVQMMIKPI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 82/224 (37%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100
FReD 275..490 CDD:238040 82/223 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.