DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and FIBCD1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001138578.1 Gene:FIBCD1 / 84929 HGNCID:25922 Length:461 Species:Homo sapiens


Alignment Length:371 Identity:114/371 - (30%)
Similarity:161/371 - (43%) Gaps:67/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TNATSNLPGKHFSVIM---RNSAEPFLLAENDTASCPVSTLAGLAARVQFMTDELQN-------- 70
            |::.:.|.....||:.   .:.|:|.|:.:.:...  :.|||....|:.....|||.        
Human   102 TDSFARLESAQASVLQALTEHQAQPRLVGDQEQEL--LDTLADQLPRLLARASELQTECMGLRKG 164

  Fly    71 ----------LKTELNELQGLIEE-------------------YKNQGTGIPIATRLLRPLPASV 106
                      |::|...|..|:.|                   .:::|.|.|.....|:..||. 
Human   165 HGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRAPAR- 228

  Fly   107 QTFPLALATPPDDTPRNCYDE-KHGQVR---IRIAPDMEP--FFASCDQKVRDGGWMVIAYRFDG 165
            .|.|...||  ...||:|.|. ..||..   ..:.|...|  |...||.:...|||.|...|.||
Human   229 GTRPRGCAT--GSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDG 291

  Fly   166 SEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIG--- 227
            |.:|.:.|..|:.|||.|..|.::||.::|.||....:||.:.::.......:|.|..|.:|   
Human   292 SVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFS 356

  Fly   228 --SESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNL 290
              .|.:.|.|.| ..|.|.|||||..|:|.:|||.|:|:|.:..|||..:.||||| |.|..|||
Human   357 VDPEEDGYPLTV-ADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY-RNCHTSNL 419

  Fly   291 FGTFQSKYGQEIGYFKGILWKSFLPGPTG---SLSYVRMLIRPLKK 333
            .|  |...|....|..|:.|.|:    ||   ||.:..|.|||:::
Human   420 NG--QYLRGAHASYADGVEWSSW----TGWQYSLKFSEMKIRPVRE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 84/225 (37%)
FIBCD1NP_001138578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238 9/26 (35%)
FReD 241..457 CDD:238040 84/223 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.