DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fgl2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:312 Identity:103/312 - (33%)
Similarity:152/312 - (48%) Gaps:48/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAARVQFMTDELQNLKTELNELQGLIEEYK------------NQGTGIPIATRLLRPLPASVQTF 109
            |.::|..::.||:|.|.|:..|||.:|..:            |:...:   |.::..|.:.....
  Rat   123 LESQVNKLSSELKNAKEEIQGLQGRLESLQLVNMNNIENYVDNKVANL---TSVVNSLDSKCFKC 184

  Fly   110 PLALATPPDDTP----RNCYD----EKHGQVRIRIAPD--MEPFFASCDQKVRDGGWMVIAYRFD 164
            |......|:...    ::|.|    .|......|:.||  ...|...||.:...|||.|:..|.|
  Rat   185 PSQEHNQPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQARLD 249

  Fly   165 GSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSE 229
            ||.:|.:.|::||||||.|..||::|.||:|.||.|:...|.|.::..:|...:|:||.|.:.:|
  Rat   250 GSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANE 314

  Fly   230 SEKYLLYVLGAYKGDAGDSLRY-----HAGKKFTTFDQDND--DNGQNCARTHAGAWWYGRECFE 287
            ..||.|: ||.|.|.|||:||:     |..:.|||.|:|||  .:| ||...::..||:. .|..
  Rat   315 FLKYRLH-LGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSG-NCGLYYSSGWWFD-ACLS 376

  Fly   288 SNLFGTFQSKYGQEI-GYFKGILWKSFLPG-----PTG---SLSYVRMLIRP 330
            :||.|.:   |.|.. |...||.|.:: ||     |.|   |....:|:|||
  Rat   377 ANLNGKY---YHQRYKGVRNGIFWGTW-PGVSQAHPGGYKFSFKKAKMMIRP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 87/238 (37%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 13/56 (23%)
Fibrinogen_C 199..425 CDD:278572 87/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.