DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Fcna

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:219 Identity:92/219 - (42%)
Similarity:115/219 - (52%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAG 179
            ||:|.|      ...|...|.: ||..|....||..|..|||.|...|.|||.:|.:||.:||.|
  Rat   123 PRSCKDLLTRGIFLTGWYTIYL-PDCRPLTVLCDMDVDGGGWTVFQRRVDGSINFYRDWDSYKRG 186

  Fly   180 FGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAY-KG 243
            ||.|.:||::|.|.||.||.:.:.||.:.:::..|:..||.|..|.:..|.|||.| .||.: :|
  Rat   187 FGNLGTEFWLGNDYLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKL-TLGQFLEG 250

  Fly   244 DAGDSLRYHAGKKFTTFDQDNDDN-GQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKG 307
            .|||||..|....|:|.|||||.| |:|||....||||| .:|.:|||.|.:..  |....|..|
  Rat   251 TAGDSLTKHNNMAFSTHDQDNDTNGGKNCAALFHGAWWY-HDCHQSNLNGRYLP--GSHESYADG 312

  Fly   308 ILWKSFLPGPTGSLSY--VRMLIR 329
            |.|   |.|.....||  ..|.||
  Rat   313 INW---LSGRGHRYSYKVAEMKIR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 92/219 (42%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 90/217 (41%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 12/39 (31%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 37/88 (42%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.