DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and Angptl1

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_082609.2 Gene:Angptl1 / 72713 MGIID:1919963 Length:490 Species:Mus musculus


Alignment Length:352 Identity:105/352 - (29%)
Similarity:162/352 - (46%) Gaps:86/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAGLAARVQFMTDELQNLKTELNELQ----GLIEEYKNQGTGI--------------------PI 94
            |:.|..::..:|.|:..:.|...||:    .|.:...||...|                    |:
Mouse   150 LSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVTITVLEEQCLRMFSRQDPHASPPL 214

  Fly    95 ATRLLRPLPASVQTFPLAL--------------ATPPDDTP---------------------RNC 124
            ...:.|..|.|.|..|..|              ..||.|.|                     ::|
Mouse   215 VQVVPRHSPNSHQYTPGLLGGNEIQRDPGYPRDVMPPPDLPTAPTKSPFKIPAVTFINEGPFKDC 279

  Fly   125 YDEK---HGQVRI-RIAPD-----MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGF 180
            ...|   |....| .|.|:     |:.:   |:..:..|||.||..|.|||.:|.::|:|||.||
Mouse   280 QQAKEAGHSASGIYMIKPENSNGLMQLW---CENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGF 341

  Fly   181 GALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDA 245
            |.::.|:::|||.:::|:|.::::|:|.::..|.::.:|.|..|.:..||:.|.|. ||.|:|:|
Mouse   342 GNIDGEYWLGLDNIYKLSNQDNYKLMIELEDWSEKKVYAEYSSFRLEPESDYYRLR-LGTYQGNA 405

  Fly   246 GDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGT------FQSKYGQEIGY 304
            |||:.:|.||:|||.|:|.|....|||..|.|.||| ..|..|||.|.      ::||:..    
Mouse   406 GDSMMWHNGKQFTTLDRDKDTYTGNCAHFHKGGWWY-NACAHSNLNGVWYRGGHYRSKHQD---- 465

  Fly   305 FKGILWKSFLPGPTGSLSYVRMLIRPL 331
              ||.|..: .|.:.||..|:|:|:|:
Mouse   466 --GIFWAEY-RGGSYSLRAVQMMIKPI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 84/247 (34%)
Angptl1NP_082609.2 RILP-like 91..207 CDD:304877 11/56 (20%)
FReD 274..489 CDD:238040 82/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.