DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and TNR

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:345 Identity:105/345 - (30%)
Similarity:161/345 - (46%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPGKHFSVIMRNSAEPFLLAENDTASCPVSTL----AGLAARVQFMTDELQNLKTELNELQGLIE 83
            ||..|::..|..:..|.   .:.|.|...|||    |.|.|........|.:.:....|::..:.
Human  1012 LPSTHYTATMYATNGPL---TSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVL 1073

  Fly    84 EYKN------------QGTGIPIATRLLRP-----LPASVQTFPLALATPPDDT-------PRNC 124
            .||:            :.|.|.:...|...     |.|:..|...::.:....|       |::|
Human  1074 TYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDC 1138

  Fly   125 Y------DEKHGQVRIRIAPDM-EPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGA 182
            .      |...|...|.:..:: :.....||.....|||:|...|.:|..||.:.|.:|:.|||.
Human  1139 AQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGN 1203

  Fly   183 LNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEE-RFALYDHFSIGSESEKYLLYVLGAYKGDAG 246
            :..||::|||.:||:|:...:||.:.|  :.|:| .||.||.||:......|.|.: |:|.|.||
Human  1204 VEDEFWLGLDNIHRITSQGRYELRVDM--RDGQEAAFASYDRFSVEDSRNLYKLRI-GSYNGTAG 1265

  Fly   247 DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-QSKYGQEIGYFKGILW 310
            |||.||.|:.|:|.|:|||....|||.::.||||| :.|..:||.|.: :|::.|.|.::.   |
Human  1266 DSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWY-KNCHRTNLNGKYGESRHSQGINWYH---W 1326

  Fly   311 KSFLPGPTGSLSYVRMLIRP 330
            |    |...|:.:|.|.:||
Human  1327 K----GHEFSIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 82/228 (36%)
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470 4/13 (31%)
FN3 1042..1127 CDD:238020 13/84 (15%)
FReD 1133..1342 CDD:238040 79/219 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.