DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC594984

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:222 Identity:81/222 - (36%)
Similarity:113/222 - (50%) Gaps:13/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PPDDTPRNCYDEKHGQVRIR-----IAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQN 175
            |...|.:||.:.......|.     ..|:..|....||.:...|||:|...|.|||.||.::|.:
 Frog   101 PAAGTAQNCKEWLDQGASISGWYTIYRPNGLPLPVFCDMETDGGGWIVFQRRKDGSVDFFQEWDS 165

  Fly   176 YKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGA 240
            ||.|||..:|||::|.:.||.||.:.:.:|.:.:........||.|.:|.||.||..|.|.:.|.
 Frog   166 YKRGFGRQDSEFWLGNENLHLLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLSLGGF 230

  Fly   241 YKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYF 305
            ..|||||||..|..::|::.|:|||.:..:||..:.|||||. .|..|||.|.:..  |:...:.
 Frog   231 TGGDAGDSLSGHKNREFSSKDRDNDSSPTSCAERYKGAWWYS-GCHTSNLNGLYLG--GKHGSFA 292

  Fly   306 KGILWKSFLPGPTGSLSY--VRMLIRP 330
            .|:.|||   |...:.||  ..|..||
 Frog   293 NGVNWKS---GGGYNYSYKVSEMKFRP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 80/219 (37%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 77/214 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.