DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angpt4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005166327.1 Gene:angpt4 / 571050 ZFINID:ZDB-GENE-110104-1 Length:496 Species:Danio rerio


Alignment Length:291 Identity:97/291 - (33%)
Similarity:135/291 - (46%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELQNLKTELNELQGLIEEYKNQGTGIPIATRLLR--------------PLPASVQTFPLALA--- 114
            ||::::.|...||.|:   |.|...|....|.||              .|..||.|....::   
Zfish   211 ELEDMREEKERLQDLV---KRQTAAITALERQLRAASSNNSALQKQHQQLMKSVHTLIGMVSSGT 272

  Fly   115 --TPPDDTPRNC---YDEKH---GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNK 171
              ||.:...|:|   |...|   |...|.|....||....||.....|||.|..:|.:||.:|.|
Zfish   273 GITPNEQRFRDCAEAYKSGHNTSGVYHIYIGDMTEPTKVFCDMVTSGGGWTVFQHRANGSVNFQK 337

  Fly   172 DWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLY 236
            .|::||.|||..:.|.::|.:.:|.:|:...:.|.:.:|.......:||||.|.:.||.::|.| 
Zfish   338 GWKDYKLGFGDPSGEHWLGNEAIHLITSQGQYSLRVELKDWEENGAYALYDKFQLTSEKQQYRL- 401

  Fly   237 VLGAYKGDAG--DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYG 299
            :||::.|.||  .||..: |..|:|.|.|||.....||....|.||: ..|..|||.|.:.: .|
Zfish   402 LLGSHSGTAGQKSSLALN-GTGFSTRDADNDKCECKCALMMTGGWWF-EACGMSNLNGIYYT-IG 463

  Fly   300 QEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            ..|....||.|..| .||:.||....|:|||
Zfish   464 HNIRKLNGIKWHHF-RGPSYSLQSTSMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/220 (36%)
angpt4XP_005166327.1 Uso1_p115_C 175..>258 CDD:282695 12/49 (24%)
FReD 281..493 CDD:238040 77/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.