DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl2a

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001025401.1 Gene:angptl2a / 569092 ZFINID:ZDB-GENE-080721-15 Length:525 Species:Danio rerio


Alignment Length:293 Identity:97/293 - (33%)
Similarity:139/293 - (47%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MTDELQN----------LKTELNE----------------LQGLIEEYKNQGTGIPIATRLLRPL 102
            ||:|:|:          |.||.:|                ||.|.|.:.|.|      ..||:  
Zfish   271 MTNEIQSDQNSKAMPSALPTEQSETHSFSTDKLSGPFKDCLQALEEGHSNSG------MFLLK-- 327

  Fly   103 PASVQTFPLALATPPDDTPRNCYDEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSE 167
                          |::|      .|..||             .|||:...|||.||..|.|||.
Zfish   328 --------------PENT------NKLMQV-------------WCDQRHDPGGWTVIQRRMDGSV 359

  Fly   168 DFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEK 232
            :|.::|:.||.|||.::.|:::||:.::.|||..:::||:.::..||.:.||.|..|.:..|::.
Zfish   360 NFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTLEDWSGRKTFAEYASFRLEPEADF 424

  Fly   233 YLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSK 297
            |.:.| |.|.|:||||:.:|.||:|||.|:|:|....|||....|.||| ..|..|||.|.:...
Zfish   425 YKMRV-GRYHGNAGDSMTWHNGKQFTTLDRDHDAYTGNCAHYQKGGWWY-NACAHSNLNGVWYRG 487

  Fly   298 YGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            ......|..|:.|..| .|.:.||..|.|:|||
Zfish   488 GHYRSRYQDGVYWAEF-RGGSYSLKKVTMMIRP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 80/212 (38%)
angptl2aNP_001025401.1 DUF1875 <50..>147 CDD:286100
Fib_alpha 119..215 CDD:285864
FReD 305..519 CDD:238040 87/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.