DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fibcd1b

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:292 Identity:96/292 - (32%)
Similarity:138/292 - (47%) Gaps:32/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPL----ALATPPDDTP 121
            :|.:::...|:...:|.:...:...:.:..|:....:      |.:|..|:    .........|
Zfish   211 IQLLSESQINMVKVVNSVSDALNAMQKETGGLKARVK------ADLQRAPVRGVRLKGCANGSRP 269

  Fly   122 RNCYD-EKHGQVR---IRIAPDMEP--FFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGF 180
            |:|.| ...||..   ..:.|...|  |...||.....|||.||..|.|||.:|.::|.:|:.||
Zfish   270 RDCSDIYASGQREDGIYSVFPTHYPAGFQVYCDMSTDGGGWTVIQRREDGSVNFFREWDSYREGF 334

  Fly   181 GALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIG-----SESEKYLLYVLGA 240
            |.:..|:::||.::|.|:...::||.|.::.......||.|..|.:|     .|.:.|.| .:..
Zfish   335 GKITGEYWLGLKQIHALSIQGNYELRIDLEDFENSTAFAQYGVFGVGLFSVDPEDDGYPL-TIAD 398

  Fly   241 YKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYF 305
            |.|.|||||..|.|.||||.|:|||.:..|||..:.||||| |.|..|||.|  |...||...|.
Zfish   399 YTGTAGDSLLKHNGMKFTTKDRDNDHSENNCASFYHGAWWY-RNCHTSNLNG--QYLRGQHTSYA 460

  Fly   306 KGILWKSFLPGPTG---SLSYVRMLIRPLKKQ 334
            .||.|.|:    ||   ||.:..|.|||.:.:
Zfish   461 DGIEWSSW----TGWQYSLKFTEMKIRPTRDE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 88/225 (39%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 87/222 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.