DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and LOC566119

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001315003.1 Gene:LOC566119 / 566119 -ID:- Length:245 Species:Danio rerio


Alignment Length:202 Identity:76/202 - (37%)
Similarity:111/202 - (54%) Gaps:10/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IAPDME-PFFASC----DQKVRD-GGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKL 194
            |.||.: |..|.|    |.:..| |||.||..|.||:.:|.:.|:.||.|||::..|.::||:.:
Zfish    44 IHPDGDHPHHAFCHMVSDGRDEDNGGWTVIQRRMDGTLNFYQPWKEYKRGFGSMEGEHWMGLEHI 108

  Fly   195 HRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTT 259
            |.:|..:.|.|.:.|:...|...||.|..||:.||.:.|.|::.|...|.|||||..|...||:|
Zfish   109 HHMTRHKRHMLRVDMEDFEGRRGFAHYTSFSVASEDDGYKLHISGFRDGGAGDSLTAHNEMKFST 173

  Fly   260 FDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQE-IGYFKGILWKSFLPGPTGSLSY 323
            ||:|.|...:||||...|.:|| ::|..:|..|.:  .:|.: ..|..|:.|.|:......||.:
Zfish   174 FDKDQDLYEKNCAREFLGGFWY-KKCHHANPNGVY--LWGHDRTHYAIGVCWWSWDHNYYNSLKH 235

  Fly   324 VRMLIRP 330
            :.|.|:|
Zfish   236 ITMRIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 76/202 (38%)
LOC566119NP_001315003.1 FReD 25..242 CDD:238040 75/200 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.