DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fgl2a

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:384 Identity:115/384 - (29%)
Similarity:170/384 - (44%) Gaps:68/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEALVTALACLSTTTN--ATSNLPGKHFSV---IMRNSAEPFLLAE--------------NDTAS 48
            ||..|..|..|..|.|  .:|.|......|   :.::|.:|....|              ||:.:
Zfish    75 LEKTVKELQSLKETVNRLKSSCLECSLKQVDLNLQKDSGDPPTEGEQSRGQTSMRVIHNGNDSDN 139

  Fly    49 CPVSTLAGLAARVQFMTDELQNLKTELNELQGLIEEYK--NQGTGIPIATRLLRPLPASVQTFPL 111
               ..:..:..::..|:..|:|.:.::|.|||.:||..  |......|..|.:..:...|.....
Zfish   140 ---DIVQNMQVKMNRMSSSLKNARAQINSLQGRLEELNLLNLQNVENIVDRKVENITGMVNKISS 201

  Fly   112 ALATPPDD----------TPRNCYDEKHGQVRI----RIAPDME--PFFASCDQKVRDGGWMVIA 160
            ...:.|..          .||:|.|......||    ::.||..  .|...||.:...|||.||.
Zfish   202 TCTSCPGQQLQLQHLTNIPPRDCSDISMLGQRINKVYQVTPDPRNGSFAVYCDMESFGGGWTVIQ 266

  Fly   161 YRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFS 225
            :|.:||..||:.|.:||.|||.|||||::|.||:|.||.::...|.|.::...|...:|.||.|.
Zfish   267 HRINGSVSFNRTWADYKKGFGNLNSEFWLGNDKIHLLTKAKDMILRIELEDSEGTRGYAKYDQFY 331

  Fly   226 IGSESEKYLLYVLGAYKGDAGDSLRY-----HAGKKFTTFDQDND--DNGQNCARTHAGAWWYGR 283
            :.:|...|.|.|.| |.|.||::|::     |..|.|||.|:|||  .:| ||...:...||:. 
Zfish   332 VSNEFLHYRLSVSG-YSGTAGNALQFSKHFNHDQKFFTTPDKDNDRYPSG-NCGAYYGSGWWFD- 393

  Fly   284 ECFESNLFGT-FQSKYGQEIGYFKGILWKSFLPGPTGSLSY-----------VRMLIRP 330
            .|..:||.|. :::||.   |...||.|.::   |..:..|           |:|:|||
Zfish   394 ACMSANLNGKYYKTKYK---GKRDGIFWGTW---PNATSEYYPTSFRQAYKNVKMMIRP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 86/247 (35%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.