DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl6

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001014821.1 Gene:angptl6 / 561927 ZFINID:ZDB-GENE-030131-9735 Length:489 Species:Danio rerio


Alignment Length:326 Identity:105/326 - (32%)
Similarity:145/326 - (44%) Gaps:64/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLAGLA---ARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIP---------IATRLLRPLPAS 105
            |||.|.   :::..:.::...|||...|||        :.|.:|         |.|.     |..
Zfish   179 TLASLVNNQSKIITLLEKQCQLKTSTKELQ--------EATSLPAQQSSVLVNINTE-----PKD 230

  Fly   106 VQ-----TFPLALAT------------PPDDTP-------------RNCY------DEKHGQVRI 134
            ||     .|..|.|.            ||.:||             .:|:      ::..|...:
Zfish   231 VQRDQSAPFHQAQARQELLETFDDSPGPPTETPFISFPSTKSPGPWHDCHNVLESGEKTSGIYLL 295

  Fly   135 RIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTN 199
            |.........|.|||....|||.||..|.|||.:|.:.|..||.|||.|:.|:::||:.|:.||:
Zfish   296 RPRNTNRLLQAWCDQSRAQGGWTVIQRRQDGSVNFFRTWDQYKQGFGNLDGEYWLGLEHLYWLTS 360

  Fly   200 SEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDN 264
            ...::|.:.|:...|.:.:|.||.|.:..||:.|.|. ||:|:|.|||||.:|..|.|||.|:|.
Zfish   361 QATYKLRVAMEDWQGRQVYAEYDSFRVEPESDWYRLR-LGSYQGTAGDSLSWHNNKAFTTLDRDK 424

  Fly   265 DDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIR 329
            |....|||....|.||| ..|..|||.|.:.........|..|:.|..| .|.:.||..|.|:|:
Zfish   425 DAYTGNCAHYQKGGWWY-HMCAHSNLNGVWYRGGHYRSRYQDGVYWAEF-HGGSYSLKKVAMMIK 487

  Fly   330 P 330
            |
Zfish   488 P 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 83/231 (36%)
angptl6NP_001014821.1 DUF1640 <46..150 CDD:285090
DUF4349 <126..230 CDD:305044 15/63 (24%)
FReD 274..488 CDD:238040 80/216 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.