DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and si:ch211-203k16.3

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_021324371.1 Gene:si:ch211-203k16.3 / 559151 ZFINID:ZDB-GENE-041014-290 Length:425 Species:Danio rerio


Alignment Length:290 Identity:89/290 - (30%)
Similarity:138/290 - (47%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQNLKTELNELQGLIEEY-KNQGTGIPIATRLLRPLPASVQTFPLALAT----PPDDTPRNC--- 124
            :.:|:.:::.|..|:|:. :|.|..|.|           |:|.||..|.    |.....|||   
Zfish   151 IYDLQAQIHNLSMLVEKVRRNPGCMINI-----------VRTSPLINAQEALHPEVQNVRNCPID 204

  Fly   125 -----YDEKHGQVRIRIAPDM--EPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGA 182
                 |:.........:.|.:  .|....||.....|||.||..|.|||.:|::.|:.||.|||.
Zfish   205 CASIYYNGVRRSGIYTVVPSLGAMPVEVYCDMDTDGGGWTVIQRRQDGSVNFDRSWKEYKEGFGD 269

  Fly   183 LNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGD 247
            |::|:::|.:.:|.||:...:.|.|.::..|.:.:.|||..||:..|:.:|.|:|.| :.|...|
Zfish   270 LHTEYWLGNEHIHDLTSQGDYMLRIDLEDWSNKHKHALYQSFSVEDENTQYRLHVSG-FSGTVED 333

  Fly   248 SLR-YHAGKKFTTFDQDNDDNGQNCAR-THAGAWWYGRECFESNLFGTF----------QSKYGQ 300
            |.. ||..:.|:|     .|.|..||. :||| ||| .:||.:||.|.:          ::..|.
Zfish   334 SFSWYHDKQGFST-----PDTGNICAEISHAG-WWY-NQCFYTNLNGIYYKGGRYSLKGKNSLGP 391

  Fly   301 EIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            :     |::|.::......||..|.|:|||
Zfish   392 D-----GVVWFTWKDSDYYSLRRVSMMIRP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 75/234 (32%)
si:ch211-203k16.3XP_021324371.1 SMC_N 73..>158 CDD:330553 1/6 (17%)
FReD 202..417 CDD:238040 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.