DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and MGC107780

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001015692.1 Gene:MGC107780 / 548409 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:219 Identity:90/219 - (41%)
Similarity:117/219 - (53%) Gaps:19/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RNCYDEKHGQVRI-----RIAPDME-PFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGF 180
            ||| .|...|..|     :|.||.| |....||.....|||:|...|:|||.||.:||.:||.||
 Frog    98 RNC-KELLDQGAILSGWYKIYPDGERPLTVLCDMDTDGGGWIVFQRRWDGSVDFFRDWDSYKKGF 161

  Fly   181 GALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYK-GD 244
            |:..|||::|.|.:|.||::..::|.|.......:..||.||.|:...|.:.|.| :||||. |.
 Frog   162 GSQLSEFWLGNDNIHTLTSAGTYKLRIDFTDFENQNSFAAYDSFATLGEKDNYKL-ILGAYSGGT 225

  Fly   245 AGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF-QSKYGQEIGYFKGI 308
            |||||.:|....|:|.|:|||.:..|||.|..|.|||| .|.:|||.|.: :.|:..|.   .||
 Frog   226 AGDSLNHHRNCPFSTKDRDNDFHNINCADTFKGGWWYG-SCHDSNLNGLYLRGKHSNEA---LGI 286

  Fly   309 LWKSFLPGPTGSLSY--VRMLIRP 330
            .|::   |.....||  ..|..||
 Frog   287 NWET---GKGNGYSYKVTEMKFRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 90/219 (41%)
MGC107780NP_001015692.1 Collagen 41..>70 CDD:189968
FReD 98..308 CDD:238040 90/219 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.