DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and fcn2

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:191 Identity:68/191 - (35%)
Similarity:99/191 - (51%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHEL 205
            :|....||.....|||:|...|:|||.:||:||.:||.|||...:||::|.:.|:.||:|...||
 Frog   127 QPMKVLCDMHTDGGGWIVFQRRWDGSVNFNRDWNSYKTGFGNRLNEFWLGNENLYELTSSGTWEL 191

  Fly   206 LIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQN 270
            .|.::.......|.:|..|.:..|::||.|.:....:|:.|:|:..|....|:|.  |||.:...
 Frog   192 RIELQDFENVNYFVIYSSFKLLGEADKYKLLLGNLKEGNIGNSMDVHVNMPFSTL--DNDVSPGK 254

  Fly   271 CARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRPL 331
            |...:.|.||| .:|..:||.|.:..  ||...|..||.|.|. .|...|..:..|.|||:
 Frog   255 CVAKYKGGWWY-NDCHHANLNGPYLP--GQHSSYADGINWASG-KGYHYSYKHSEMKIRPV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 67/189 (35%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 67/189 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.