DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl1a

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001014820.1 Gene:angptl1a / 544656 ZFINID:ZDB-GENE-040724-269 Length:480 Species:Danio rerio


Alignment Length:339 Identity:105/339 - (30%)
Similarity:155/339 - (45%) Gaps:64/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAGLAARVQFMTDELQNLKTELNELQ----GLIEEYKNQ-------------GTG---IPIATRL 98
            ||.|..||..:|.|:..|.:...||:    ||.....||             |.|   :|....|
Zfish   144 LAQLENRVLNVTTEMLRLASRYKELEMRFAGLAGTVNNQSVLIAALEERCLRGYGRQDLPAVPPL 208

  Fly    99 LRPLPASV-----------------QTF------------PLALATPPD-----DTP-RNCYDEK 128
            ::.:|.|:                 :.|            ||.:..||.     |.| ::|...:
Zfish   209 VQVVPESIPANNNRFTNEIQRDNNNRAFPRGSRMDTPTPDPLGIPPPPQGTLTADGPFKDCSQVR 273

  Fly   129 H------GQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEF 187
            .      |...::.........|.|:.|:.:|||.|...|.|||.:|.::|:|||.|||.::.|.
Zfish   274 QAGHSTSGMYLLKAEGSDRLIQAWCEHKLDNGGWTVFQRRKDGSVNFFRNWENYKKGFGNIDGEH 338

  Fly   188 FIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYH 252
            ::||:.::.|.....::||:.::...|::.:|.|..|.:..|||.:.|. ||.|:|:|||||..|
Zfish   339 WLGLENIYNLAKQGDYKLLVELEDWVGKKVYAEYSSFHLEPESEGFRLR-LGTYQGNAGDSLTSH 402

  Fly   253 AGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGP 317
            .||.|||.|:|.|....|||..|.|.||| ..|.::||.|.:.|.......:..||.|..: .|.
Zfish   403 NGKPFTTLDRDKDAFTGNCAHFHKGGWWY-NACGQTNLNGVWYSGGVYRSKFQDGIFWAEY-GGG 465

  Fly   318 TGSLSYVRMLIRPL 331
            ..||..|||:|||:
Zfish   466 YYSLKSVRMMIRPI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/218 (36%)
angptl1aNP_001014820.1 FReD 264..479 CDD:238040 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.