DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and ANGPT4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_057069.1 Gene:ANGPT4 / 51378 HGNCID:487 Length:503 Species:Homo sapiens


Alignment Length:289 Identity:87/289 - (30%)
Similarity:137/289 - (47%) Gaps:39/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAGLAARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPD 118
            |.|:......:.|:..:|:..|..|:.|::|..|                ||...|.:|    .:
Human   241 LRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERAN----------------ASAPAFIMA----GE 285

  Fly   119 DTPRNCYD------EKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYK 177
            ...::|.:      ...|...|:::...:|....||.:...|.|.:|..|.:|:.:|.::|::||
Human   286 QVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYK 350

  Fly   178 AGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYK 242
            .|||....|.::|.:.:|:||....:.|.:.::...|.|.:|.|:||.:|||::.|.|.|:| |.
Human   351 QGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVG-YS 414

  Fly   243 GDAG-DSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTF----QSKYGQEI 302
            |.|| .|........|:|.|.|||.....||:..:|.||:. .|..|||.|.:    .:||..: 
Human   415 GSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFD-ACGLSNLNGVYYHAPDNKYKMD- 477

  Fly   303 GYFKGILWKSFLPGPTGSLSYVRMLIRPL 331
                ||.|..| .||:.||...||:||||
Human   478 ----GIRWHYF-KGPSYSLRASRMMIRPL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 72/222 (32%)
ANGPT4NP_057069.1 FReD 288..501 CDD:238040 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.