DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl2b

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001119950.1 Gene:angptl2b / 503514 ZFINID:ZDB-GENE-050624-1 Length:519 Species:Danio rerio


Alignment Length:269 Identity:93/269 - (34%)
Similarity:137/269 - (50%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATP-----PDDTPRNC---YDEKHGQV 132
            ||:|      .:|...:|         ||...|.|....:|     |....::|   .::.|...
Zfish   266 NEIQ------SDQNLKVP---------PAPPPTMPGGTHSPSTTNKPSGPWKDCLEALEDGHTNS 315

  Fly   133 RIR-IAPD-----MEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGL 191
            .:. :.||     |:.:   |||:...|||.||..|.|||.:|.::|:.||.|||.::.|:::||
Zfish   316 GMHLVKPDNTNKLMQVW---CDQRQDPGGWTVIQRRMDGSVNFFRNWETYKQGFGNIDGEYWLGL 377

  Fly   192 DKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKK 256
            :.::.:||..:::||:.::..||.:.||.|..|.:..|::.|.|.| |.|.|:|||||.:|.||:
Zfish   378 ENIYWITNQGNYKLLVTLEDWSGRKTFAEYASFRLEPEADFYRLRV-GRYHGNAGDSLTWHNGKQ 441

  Fly   257 FTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSL 321
            |||.|:|:|....|||....|.||| ..|..|||.|.:.........|..|:.|..| .|...||
Zfish   442 FTTLDRDHDVYTGNCAHYQKGGWWY-NACAHSNLNGVWYRGGHYRSRYQDGVYWAEF-RGGAYSL 504

  Fly   322 SYVRMLIRP 330
            ..|.|:|||
Zfish   505 KKVVMMIRP 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 82/221 (37%)
angptl2bNP_001119950.1 RILP-like 98..216 CDD:304877
FReD 299..513 CDD:238040 80/219 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.