DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl4

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001243132.1 Gene:angptl4 / 492647 ZFINID:ZDB-GENE-041111-222 Length:460 Species:Danio rerio


Alignment Length:281 Identity:85/281 - (30%)
Similarity:131/281 - (46%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQNLKTELNELQGL--IEEYKNQGTGIPIATRLLRPLPASVQ--TFPLALATPPDDTPRNCY--- 125
            |||..|..||...|  :||..|              |.||.:  ..|:|||:       :|:   
Zfish   203 LQNQITMKNERLSLKRMEEDVN--------------LNASTEQRDSPVALAS-------DCHELF 246

  Fly   126 ---DEKHGQVRIRIAPDMEPFFASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGALNSEF 187
               :...|...|: ..|.:||...|:. ..:|||.||..|.|||.||::.||.|:.|||.||.||
Zfish   247 LRGETSSGLYTIQ-PSDSQPFEVYCEM-TPEGGWTVIQRRQDGSVDFDQLWQAYQNGFGNLNGEF 309

  Fly   188 FIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYH 252
            ::||:|:|.::...::.|.:.......|.:...| .|.:..:...|.|.:|.:..|:...||...
Zfish   310 WLGLEKIHSVSKGGNYILKVQFSDWRDEIQSISY-RFHLNGQENNYSLRILESPAGNTESSLPTE 373

  Fly   253 -AGKKFTTFDQDNDD-NGQNCARTHAGAWWYGRECFESNLFGTF------QSKYGQEIGYFKGIL 309
             :...|:|.|:|||. |..|||:..:|.||:. .|..|||.|.:      :.::.::    :|:.
Zfish   374 TSAVPFSTRDKDNDQKNDLNCAKQLSGGWWFS-NCGRSNLNGRYFVTPAPKQRHQRK----QGVF 433

  Fly   310 WKSFLPGPTGSLSYVRMLIRP 330
            ||:: .|....|....|:|.|
Zfish   434 WKTW-RGRYYPLKTTTMMIAP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 68/226 (30%)
angptl4NP_001243132.1 DUF4795 78..>224 CDD:292662 9/20 (45%)
FReD 240..453 CDD:238040 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.