DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and angptl7

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001006073.1 Gene:angptl7 / 450053 ZFINID:ZDB-GENE-041010-175 Length:338 Species:Danio rerio


Alignment Length:303 Identity:92/303 - (30%)
Similarity:139/303 - (45%) Gaps:46/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DELQNLKTELNELQGLIEEY-KNQGTGIPIATRLLRPL-----------------------PASV 106
            ||:::||.::..|..::||. |.|.:.:....|.:..|                       ...:
Zfish    39 DEVRSLKVQVANLSSMLEELNKKQESELMKVVRQMMELEKLNQQQEARVTEAESKYSEIYNQIEI 103

  Fly   107 QTFPLALATPPDDTPRNCYD---------EKHGQVRIRI-----APDMEPFFASCDQKVRDGGWM 157
            .....|.:.|...|....||         :..|:.::..     .|::..|   ||.:...|||.
Zfish   104 MQLQAAQSAPQQSTSDAIYDCASLYNKNYKISGEYKLPKDDFLGTPELNVF---CDMENNGGGWT 165

  Fly   158 VIAYRFDGSEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYD 222
            :|..|..|...||:||:.||.|||.:..:|::|.:.:.|:|. :...|.|.|:...|:.|:|.|.
Zfish   166 LIQRRKIGLTSFNRDWKQYKNGFGTIRGDFWLGNEHIFRMTR-QPTVLRIEMEDWEGDVRYAEYG 229

  Fly   223 HFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFE 287
            .|::.:|...|.| ::..|.|:||||||||....|:|.::|||....|||:...|.:||.. |.:
Zfish   230 FFTLSNEMNSYKL-LIANYSGNAGDSLRYHNNTNFSTKNKDNDKCLDNCAQLRQGGYWYNC-CTD 292

  Fly   288 SNLFGTFQSKYGQEIGYFKGILWKSFLPGPTGSLSYVRMLIRP 330
            |||.|.|. :||.......||.|..: .||..||..|.|.|||
Zfish   293 SNLNGVFY-RYGSHTKNPDGISWYGW-HGPNYSLKRVEMKIRP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/226 (35%)
angptl7NP_001006073.1 FReD 122..333 CDD:238040 76/218 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.